SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|512615797|ref|YP_008100481.1| from Pseudomonas resinovorans NBRC 106553

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|512615797|ref|YP_008100481.1|
Domain Number 1 Region: 22-113
Classification Level Classification E-value
Superfamily Periplasmic binding protein-like II 5.98e-20
Family Phosphate binding protein-like 0.0000785
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|512615797|ref|YP_008100481.1|
Sequence length 136
Comment sulfate ABC transporter substrate-binding protein CysP [Pseudomonas resinovorans NBRC 106553]
Sequence
MSIRRFALAALASALIAGPAAAATELLNVSYDPTRELYQEYNAAFVKHWKAQGGDDLKVQ
QSHGGSGKQARAVIDGLKADVVTLALAGDIDELQKLGKLIPENWQARLPDNSTPTPRPSC
SWCARATPRASRTGAT
Download sequence
Identical sequences S6AQ30
gi|512615797|ref|YP_008100481.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]