SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|166362859|ref|YP_001655132.1| from Microcystis aeruginosa NIES-843

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|166362859|ref|YP_001655132.1|
Domain Number 1 Region: 12-226
Classification Level Classification E-value
Superfamily PLP-binding barrel 8.63e-23
Family Alanine racemase-like, N-terminal domain 0.018
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|166362859|ref|YP_001655132.1|
Sequence length 361
Comment putative amino acid racemase [Microcystis aeruginosa NIES-843]
Sequence
MKDLLPRIEISLPKIRHNARLLCQFYGSKGLSVMGVSKAILGDPSIALAMIQGGVNFIAD
SRIENILKMKQAGIVTTFVLLRTALSQAESVVNIADISLNTELATIQELSYYAQEKQKIH
RIIIMTELGDLREGVLPKDLVKFIKKTLAFPFIKIIGLGCNLACYGGIKPDSHNMSKLSV
LTDTIEQEFLIKLPIISGGNSANYQWYQKSSEVGRINNLRLGESILLGCETVNRQVIPGL
YTDAFRLIAEVIESKDKPSLPSGEIGRDAFGNVPSFIDQGIHRRVIIALGRQDILISGLQ
TSQEIKILGSSSDHLVLDSHNKRLKVGSEVSFNLDYGGLLTAMTSPFITKSYALNAVAQL
S
Download sequence
Identical sequences B0JFH8 I4FV52 I4HUE5
WP_002762913.1.24258 WP_002762913.1.4043 WP_002762913.1.50331 449447.MAE_01180 gi|166362859|ref|YP_001655132.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]