SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|166362864|ref|YP_001655137.1| from Microcystis aeruginosa NIES-843

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|166362864|ref|YP_001655137.1|
Domain Number 1 Region: 37-315
Classification Level Classification E-value
Superfamily Nucleotidylyl transferase 5.82e-82
Family Class I aminoacyl-tRNA synthetases (RS), catalytic domain 0.000000175
Further Details:      
 
Domain Number 2 Region: 299-403
Classification Level Classification E-value
Superfamily Alpha-L RNA-binding motif 0.00000000000000122
Family Tyrosyl-tRNA synthetase (TyrRS), C-terminal domain 0.0088
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|166362864|ref|YP_001655137.1|
Sequence length 405
Comment tyrosyl-tRNA synthetase [Microcystis aeruginosa NIES-843]
Sequence
MTVSSSLDWLTRGTSDLFPHQPDSQDPRENLTQLLQTTDRPLRIKLGIDPTGSDIHLGHS
IPFRKLRAFQDAGHVAVVIIGDFTARIGDPTGKSEVRKQLTSEEVRANAENYLAQLRPIL
DFNTPNRLEIRYNSEWLGKLDLSQILELLSTMTVGQMLAKEGFSERYDQEKPIFLHEFLY
PLMQGYDSVAVEADVELGGTDQKFNIVVGRDLQKYFGKTPQFGLLLPILIGTDGSQKMSK
SLNNYVGLRESALSMYSKLEKTPDALLKDYYELLTNLPLDAMASNPREAQKQLAIEVVAQ
FHGKEEALKAQKTAQEIVLQGNTAAAASVPEFSLAAVTFPLKLFYLLSATGLCKSSGEGR
RQIQGGAVRIDSEKITDVDKSFETAEALTGKVLQVGKNKFIRFVA
Download sequence
Identical sequences B0JFI3 I4HUF8
449447.MAE_01230 WP_002797516.1.4043 WP_002797516.1.50331 gi|166362864|ref|YP_001655137.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]