SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|166362881|ref|YP_001655154.1| from Microcystis aeruginosa NIES-843

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|166362881|ref|YP_001655154.1|
Domain Number 1 Region: 27-138
Classification Level Classification E-value
Superfamily Homeodomain-like 0.000000000000555
Family Cgl2762-like 0.073
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|166362881|ref|YP_001655154.1|
Sequence length 207
Comment transposase [Microcystis aeruginosa NIES-843]
Sequence
MPAKDFLDLEEKKNLQKALKEEERAEVRERILMFLLLNDGKTQREIADFIGCSLKTVAHW
CVHGDPNNLESLEDGRKNGNHKKATEEYINLLLKIVDEDPKEFGYEFGRWTAARLAEHLE
KETGIKLSGSQVRRILRRKKYVYIWAKYSLEDKQDKKLRKAFKEKLDEYLRLAKEKPESI
QVWFWDGAFKVATQVRHRVPLMNVDLV
Download sequence
Identical sequences B0JRB7
449447.MAE_01400 gi|166362881|ref|YP_001655154.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]