SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|166362950|ref|YP_001655223.1| from Microcystis aeruginosa NIES-843

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|166362950|ref|YP_001655223.1|
Domain Number 1 Region: 174-398
Classification Level Classification E-value
Superfamily Argininosuccinate synthetase, C-terminal domain 2.62e-90
Family Argininosuccinate synthetase, C-terminal domain 0.00000139
Further Details:      
 
Domain Number 2 Region: 5-206
Classification Level Classification E-value
Superfamily Adenine nucleotide alpha hydrolases-like 4.63e-44
Family N-type ATP pyrophosphatases 0.00000708
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|166362950|ref|YP_001655223.1|
Sequence length 401
Comment argininosuccinate synthase [Microcystis aeruginosa NIES-843]
Sequence
MGRAKRVVLAYSGGVDTSVCIPYLKQEWGVEEVITLAADLGQGDELGPIQEKALRCGAIE
SLVVNAQEEFVKEYAFPSIQANALYENRYPLSTALARPLIAKLLVEAAEKYGADAVSHGC
TGKGNDQVRFDVGIMALNPSLKVLAPAREWGMSREETIAYGEKFGIESPVKKSSPFSIDR
NLLGRSIEAGPLEDPMTEPPEEIYLMTKAIADTPNEPEYVDIGFNQGIPVSLNGENLAPV
TLISQLNDLVGKHGVGRLDMIENRVVGIKSREIYEAPALLVLIDAHRDLESLTLTGDVTQ
YKRGIEDTYGQLIYKGLWYSPLKEAIDAFILKTQEQVTGSVRVKLFKGNAKVVGRQSVNS
IYSPDLATYGAEDQFDHKAAEGFIYVWGLPSKVWAEKTRGK
Download sequence
Identical sequences A0A139GNA5 B0JM14 I4HUT4
449447.MAE_02090 WP_002797600.1.4043 WP_002797600.1.50331 WP_002797600.1.52201 gi|166362950|ref|YP_001655223.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]