SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|166362954|ref|YP_001655227.1| from Microcystis aeruginosa NIES-843

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|166362954|ref|YP_001655227.1|
Domain Number 1 Region: 102-296
Classification Level Classification E-value
Superfamily Glutathione synthetase ATP-binding domain-like 1.47e-50
Family BC ATP-binding domain-like 0.00021
Further Details:      
 
Domain Number 2 Region: 4-98
Classification Level Classification E-value
Superfamily PreATP-grasp domain 1.31e-26
Family BC N-terminal domain-like 0.0059
Further Details:      
 
Domain Number 3 Region: 302-359
Classification Level Classification E-value
Superfamily Rudiment single hybrid motif 0.000000000000033
Family BC C-terminal domain-like 0.0027
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|166362954|ref|YP_001655227.1|
Sequence length 375
Comment phosphoribosylaminoimidazole carboxylase ATPase subunit [Microcystis aeruginosa NIES-843]
Sequence
MMQTRVGVIGGGQLAWMMAQEAKKLGISLIVQTPHPDDPAVALADGVVFAEIADVEGTKK
LAQHCDLITFENEFVNLDALEELAATGVKFYPSLANLRPLLDKYEQRCYLRSLGLPVPDF
WAIDNLSPLENYPFPLVLKARRQGYDGQGTFIIRTPEELNAKKPQLERLDLMLEAYIPYE
RELAIVAARGLTGEIVTYPVVETYQEEQVCHWVIAPAALNQSLQAQTESIAHHLLSSLSA
VGVFGIELFVTPQGEVLINEIAPRTHNSGHYSLSACLTSQFALQLQAVANLPLGATDLKS
AGAVMVNLLGFEDSDGDYGEKRAILAAIPDAQVFWYGKKSRPGRKLGHVTLLRDTSDRSE
LLALAKQIEKLWYGC
Download sequence
Identical sequences B0JM18
449447.MAE_02130 WP_012263927.1.4043 gi|166362954|ref|YP_001655227.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]