SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|166363094|ref|YP_001655367.1| from Microcystis aeruginosa NIES-843

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|166363094|ref|YP_001655367.1|
Domain Number 1 Region: 4-77
Classification Level Classification E-value
Superfamily Chaperone J-domain 9.94e-22
Family Chaperone J-domain 0.00058
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|166363094|ref|YP_001655367.1|
Sequence length 229
Comment molecular chaperone [Microcystis aeruginosa NIES-843]
Sequence
MTGNHYQTLEISHKSTPDEIKRAYRRLARQFHPDSQNDSASHDKIVAINAAYEILSDPRL
RKDYDNQLIANFPEKRGQRTATAQANYHRYKEAVQEDEALVKQWYNQTYSPINRLIGQII
RPLKGQIDHLSADPFDDQLMAVFQDYLETCRQNLDRAKTLFCQRPNPAKMAKVAASLYYC
LNHLTDGLEELETFTLNYDDRSLHTGQEMFRMAQRLQVEAKQIASQCQN
Download sequence
Identical sequences B0JN11 I4FVC9 I4HVJ5
WP_002763029.1.24258 WP_002763029.1.4043 WP_002763029.1.50331 449447.MAE_03530 gi|166363094|ref|YP_001655367.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]