SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|166363422|ref|YP_001655695.1| from Microcystis aeruginosa NIES-843

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|166363422|ref|YP_001655695.1|
Domain Number 1 Region: 1-155
Classification Level Classification E-value
Superfamily Nucleotidylyl transferase 1.56e-42
Family Adenylyltransferase 0.0000169
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|166363422|ref|YP_001655695.1|
Sequence length 157
Comment phosphopantetheine adenylyltransferase [Microcystis aeruginosa NIES-843]
Sequence
MIAIYPGSFDPVTLGHLDIIERSVPLFERVIVAVLCNPHKNPLFTVEKRIEQISYCTKHL
KNVEIDSFSGLTVEYARLKGAKVLLRGLRVLSDFEKELQMAHTNKTLWEGIETVFLATTK
EYSFLSSSVVKEIAQFGGSVTHLVPENVSRDIYSYYS
Download sequence
Identical sequences A0A139GR60 A0A1V4BQD4 B0JPJ2 I4FK33 I4GBD1 I4H7N4 I4HGP9
gi|166363422|ref|YP_001655695.1| WP_002758057.1.24258 WP_002758057.1.4043 WP_002758057.1.43975 WP_002758057.1.50331 WP_002758057.1.52201 WP_002758057.1.6707 WP_002758057.1.77316 WP_002758057.1.79847 449447.MAE_06810

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]