SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|166363468|ref|YP_001655741.1| from Microcystis aeruginosa NIES-843

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|166363468|ref|YP_001655741.1|
Domain Number 1 Region: 131-318
Classification Level Classification E-value
Superfamily Glutathione synthetase ATP-binding domain-like 3.53e-52
Family ATP-binding domain of peptide synthetases 0.0000318
Further Details:      
 
Domain Number 2 Region: 1-129
Classification Level Classification E-value
Superfamily PreATP-grasp domain 2.01e-34
Family Prokaryotic glutathione synthetase, N-terminal domain 0.00095
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|166363468|ref|YP_001655741.1|
Sequence length 326
Comment glutathione synthetase [Microcystis aeruginosa NIES-843]
Sequence
MKLAFIIDPIEYLDPGHDTSVAIMEASQLLGHEVWMTSITDLSAIAGKAWAKLTKIELVP
VELKDNHWEAVSQWYQRQETVFTCLENFDFVWMRKDPPVTIAYLYATYLLDLIDPQKTQV
INSTRGLRHANEKLYTIHFAQVMPATIVSQDKATIREFVNQKGAAVMKPLGGKAGEGILF
LSPEDRNLNSMIEISTKWGQEPVMIQDYLPAAKEGDKRIIVLNGEPIGAVNRIPTGSEFR
GNMAVGGRVAKTEISDQELEICATLAPKLREDGLYFVGLDVIGGYLTEVNVTSPTGIREI
DRLNNVSLGQQVIKWLENFACAKALS
Download sequence
Identical sequences B0JQ90
gi|166363468|ref|YP_001655741.1| 449447.MAE_07270 WP_012264298.1.4043

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]