SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|166363472|ref|YP_001655745.1| from Microcystis aeruginosa NIES-843

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|166363472|ref|YP_001655745.1|
Domain Number 1 Region: 65-151
Classification Level Classification E-value
Superfamily Ribosomal protein L9 C-domain 1.96e-20
Family Ribosomal protein L9 C-domain 0.00071
Further Details:      
 
Domain Number 2 Region: 5-60
Classification Level Classification E-value
Superfamily L9 N-domain-like 1.24e-18
Family Ribosomal protein L9 N-domain 0.00067
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|166363472|ref|YP_001655745.1|
Sequence length 152
Comment 50S ribosomal protein L9 [Microcystis aeruginosa NIES-843]
Sequence
MAKRMQVILNQKVSKLGENGDVVEVAPGYARNYLIPQGVAVLATKGAIKQAEFRKEKERQ
RLLAEKQEAETRKTAIEKLSPYSIPKQVGENEAIFGTVTSQDVATVILENAKLEIDRRGI
TVPDIGQLGVYKVQVKLHPEVSADIEIKVIAQ
Download sequence
Identical sequences A0A139GQR8 B0JQ94
gi|166363472|ref|YP_001655745.1| WP_012264300.1.39664 WP_012264300.1.4043 WP_012264300.1.50673 WP_012264300.1.52201 449447.MAE_07310

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]