SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|166363561|ref|YP_001655834.1| from Microcystis aeruginosa NIES-843

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|166363561|ref|YP_001655834.1|
Domain Number 1 Region: 1-188
Classification Level Classification E-value
Superfamily ITPase-like 8.63e-64
Family ITPase (Ham1) 0.0000226
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|166363561|ref|YP_001655834.1|
Sequence length 197
Comment HAM1 protein [Microcystis aeruginosa NIES-843]
Sequence
MKKLILATSNPGKLAEIGEYLTDIDLELQLKPDDLEIEETGATFAENAYLKAAQIALTLG
EWSIADDSGLEVTGLGNAPGIYSARYGENDRERIDRLVRELGDNQDRSARFVCVIAIARP
DGEIALTATGICTGEILTSPRGKGGFGYDPIFYVPEYALTFAEMSPELKRKISHRGRAFQ
QLLPHLKTLAGTNSLRL
Download sequence
Identical sequences B0JQI3
449447.MAE_08200 WP_012264363.1.4043 gi|166363561|ref|YP_001655834.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]