SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|166363690|ref|YP_001655963.1| from Microcystis aeruginosa NIES-843

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|166363690|ref|YP_001655963.1|
Domain Number 1 Region: 2-30
Classification Level Classification E-value
Superfamily Subunit XII of photosystem I reaction centre, PsaM 0.00000000011
Family Subunit XII of photosystem I reaction centre, PsaM 0.0011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|166363690|ref|YP_001655963.1|
Sequence length 30
Comment photosystem I reaction center subunit XII [Microcystis aeruginosa NIES-843]
Sequence
MLSDTQVLVALVIALIPGILAFRLATELYK
Download sequence
Identical sequences A0A139GQ21 A0A1V4BY86 A0A2I9CFA5 B0JRM1 S3JFG9
449447.MAE_09490 gi|166363690|ref|YP_001655963.1| WP_012264462.1.10452 WP_012264462.1.13945 WP_012264462.1.15998 WP_012264462.1.20667 WP_012264462.1.23084 WP_012264462.1.24258 WP_012264462.1.39664 WP_012264462.1.4043 WP_012264462.1.42333 WP_012264462.1.43950 WP_012264462.1.43975 WP_012264462.1.50331 WP_012264462.1.50673 WP_012264462.1.52201 WP_012264462.1.5315 WP_012264462.1.6707 WP_012264462.1.77316 WP_012264462.1.7764 WP_012264462.1.79847 WP_012264462.1.86711 WP_012264462.1.92877 WP_012264462.1.98808

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]