SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|166363867|ref|YP_001656140.1| from Microcystis aeruginosa NIES-843

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|166363867|ref|YP_001656140.1|
Domain Number 1 Region: 70-205
Classification Level Classification E-value
Superfamily SMAD/FHA domain 3.83e-23
Family FHA domain 0.0029
Further Details:      
 
Weak hits

Sequence:  gi|166363867|ref|YP_001656140.1|
Domain Number - Region: 28-51
Classification Level Classification E-value
Superfamily Zn-binding ribosomal proteins 0.0439
Family Ribosomal protein S27a 0.044
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|166363867|ref|YP_001656140.1|
Sequence length 208
Comment FHA domain-containing protein [Microcystis aeruginosa NIES-843]
Sequence
MIVCPNCEHTNPDEASQCEACYTPLPRMSSCPSCGATIQTDATFCGQCGYNLQPNSVPMV
AAQPESEPEPVPPVPTPTVASIAPPPVAPPPVRAATRLQTEIASLQHLQTDSKIELPLHL
SVIHIGKPNDRIPPDIDVSGFPDSDIVSRVHGDIRVEAGLYYLEDSGSANGTYVNHTPLP
PGNRHRLRAGDRISLGKGDKMTFIFQMS
Download sequence
Identical sequences B0JSQ4 I4I4E8
449447.MAE_11260 WP_004163407.1.4043 WP_004163407.1.50331 gi|166363867|ref|YP_001656140.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]