SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|166364066|ref|YP_001656339.1| from Microcystis aeruginosa NIES-843

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|166364066|ref|YP_001656339.1|
Domain Number 1 Region: 175-438
Classification Level Classification E-value
Superfamily Creatinase/aminopeptidase 2.62e-81
Family Creatinase/aminopeptidase 0.000000263
Further Details:      
 
Domain Number 2 Region: 3-174
Classification Level Classification E-value
Superfamily Creatinase/prolidase N-terminal domain 3.66e-52
Family Creatinase/prolidase N-terminal domain 0.0000939
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|166364066|ref|YP_001656339.1|
Sequence length 439
Comment aminopeptidase P [Microcystis aeruginosa NIES-843]
Sequence
MSIDRREFQHRRQQVMEKIGHGTAIFRSAPMAVMHNDVEYTYRQDSDFFYLTGFNEPDAV
AILAPHHPEHQFILFVQPKDPEKETWTGYLHGVEGAKEIFAADEAYSIEELEEKLPQYLE
KAERIYYHLGRDKTFNTNVLNHWQKLIATFPRRGTGPTALEDTNFILHPLRLLKTAAELD
NIRKATAISAQAHNRAREFTKVGHYEYQIQAEIEHTFRLEGGMGPAYPSIVASGANACIL
HYINNNRQVQENELLLIDAGCAYNYYNGDITRTFPVNGKFTPEQKIIYEIVLEAQLKAIE
VVKTGHPYNLFHDTAVRTIVEGLVDLGLLVGPIDEIIKEEKYKPFYMHRTGHWLGLDVHD
AGGYKVNEETWQTLQPGHVLTVEPGIYISPDIKPAEGQPEVPEKWRGIGIRIEDDVLVTA
TGNEVLTATVPKKVEDIES
Download sequence
Identical sequences B0JTV9
gi|166364066|ref|YP_001656339.1| WP_012264757.1.4043 449447.MAE_13250

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]