SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|166364178|ref|YP_001656451.1| from Microcystis aeruginosa NIES-843

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|166364178|ref|YP_001656451.1|
Domain Number 1 Region: 174-417
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 9.29e-72
Family Extended AAA-ATPase domain 0.0000000367
Further Details:      
 
Domain Number 2 Region: 427-620
Classification Level Classification E-value
Superfamily FtsH protease domain-like 4.84e-65
Family FtsH protease domain-like 0.00000446
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|166364178|ref|YP_001656451.1|
Sequence length 631
Comment cell division protein [Microcystis aeruginosa NIES-843]
Sequence
MDQKSPLTVVRAKSAKNRGRRPVWKGIVTTWMILQTFGHVTPAWSQKNQNTLTYGELLEK
IDQGKVKKVEINPSLQQAAVTLVGQTDKDPPKEVNLFDQNPELIKKLDAEKIEYGILPST
DNSALINVLTNLLVIILVLGLLVFIIRRSANASGQAMNFGKSRARFQMEAKTGIEFNDVA
GVDEAKEDLEEVVTFLKQPEKFTAIGAKIPKGVLLIGPPGTGKTLLAKAIAGEAGVPFFS
ISGSEFVEMFVGVGASRVRDLFRKAQENAPCLVFIDEIDAVGRQRGIGYGGGNDEREQTL
NQLLTEMDGFEGNTGIIVIAATNRPDVLDSALLRPGRFDRQVVVDYPDSKGRLAILEVHS
RYKKVAADVALEAIARRTPGFTGADLANMLNEAAIFTARRRKEAITMEEVNDAIDRIVAG
MEGRALVDSKAKRLIAYHEVGHAIVGTLCPGHDQVEKVTLIPRGQAQGLTWFTPDEEQGL
TSRSQLLARIAGLLGGRVAEECVFGEDEVTTGAGNDIEKITYLARQMVTRLGMSELGLIA
LEEEGNSYLGGAAAGYHADHSFAMMAKIDSQVRELVKQCHDLATKLILDNRVAIDRLVDI
LIEQETIDGDEFRRLLTEFQQQAARSMVTTV
Download sequence
Identical sequences B0JU71
gi|166364178|ref|YP_001656451.1| 449447.MAE_14370 WP_012264845.1.4043

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]