SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|166364185|ref|YP_001656458.1| from Microcystis aeruginosa NIES-843

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|166364185|ref|YP_001656458.1|
Domain Number 1 Region: 212-327
Classification Level Classification E-value
Superfamily HprK N-terminal domain-like 2.62e-32
Family DRTGG domain 0.00023
Further Details:      
 
Domain Number 2 Region: 6-223
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 5.31e-26
Family Nitrogenase iron protein-like 0.023
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|166364185|ref|YP_001656458.1|
Sequence length 358
Comment hypothetical protein MAE_14440 [Microcystis aeruginosa NIES-843]
Sequence
MAKSAKSILISSLEPLSGKSGTIVGLAHLLRQKGLEISYGKPVGNCPGYVDGQLVDEDVE
FIQQLLELSPEQLRLPLIYTDMDSVAKRLQGADKQDYGNILAGYLDRVNSDIALLEGPGT
LWEGSIFQLSMGEMAKILQTPILLVARYSSPLIADSLLKAQQELNNQLLGVVISDIPADD
WDEVQSLLKPYLAGQGVEVLGLLPASKLMRSISVREIVHLLEAKVLCRPDRLDWMVESLA
IGAMNVNAALEYFRKGENMAVITGGDRTDLQLAALETSTTCLILTGSISPDPLILGRAED
LEVPILSVNLDTLTTVEIVDRAFGKIRLQEQVKVACIRELMEEHFQIDRLLEKLTTGG
Download sequence
Identical sequences B0JU78 I4I0V0
WP_002798557.1.4043 WP_002798557.1.50331 gi|166364185|ref|YP_001656458.1| 449447.MAE_14440

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]