SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|166364457|ref|YP_001656730.1| from Microcystis aeruginosa NIES-843

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|166364457|ref|YP_001656730.1|
Domain Number 1 Region: 25-247
Classification Level Classification E-value
Superfamily Class I glutamine amidotransferase-like 1.25e-55
Family Class I glutamine amidotransferases (GAT) 0.0000111
Further Details:      
 
Domain Number 2 Region: 207-434
Classification Level Classification E-value
Superfamily Adenine nucleotide alpha hydrolases-like 7.72e-55
Family N-type ATP pyrophosphatases 0.00000224
Further Details:      
 
Domain Number 3 Region: 421-541
Classification Level Classification E-value
Superfamily GMP synthetase C-terminal dimerisation domain 6.15e-53
Family GMP synthetase C-terminal dimerisation domain 0.0000146
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|166364457|ref|YP_001656730.1|
Sequence length 541
Comment GMP synthase [Microcystis aeruginosa NIES-843]
Sequence
MTTQTPLPTPQETLPSESFTNSLNRQIIIILDFGSQYSELIARRIRETNVYSEVLSYRTS
AEQLAQINPKGIILSGGPNSVYDPGAPHCDPEIWNLGVPVLGVCYGMQLMVQQLGGRVER
AKRAEYGKASLFINDPTDLLTNVEDGSTAWMSHGDSCVELPAGFEILAHTDNTDCAAIAD
HKKKLFGVQFHPEVVHSVGGIALIRNFVYHICKCEPTWTTEAFVEESIREIRAKVGDKRV
LLALSGGVDSSTLAFLLHRAIGDQLTCMFIDQGFMRKGEPERLMQIFNEQFHIRVEYVNA
RERFLAQVAGVTDPEEKRRRIGHEFIQVFEEESNRLGPFDYLAQGTLYPDVIESADSNVD
PKTGERVAVKIKSHHNVGGLPKNLRFKLVEPLRKLFKDEVRKLGRSIGLPEEIVRRQPFP
GPGLAIRILGEVTADKLNILRDADWVVRDEINKQGMYHDFWQAFAVLLPVRSVGVMGDQR
TYAYPIVLRLVSSEDGMTADWSRVPYDLLETISNRIVNEVKGVNRVVYDITSKPPGTIEW
E
Download sequence
Identical sequences A0A1V4BVM1 B0JW58
WP_012265044.1.4043 WP_012265044.1.79847 449447.MAE_17160 gi|166364457|ref|YP_001656730.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]