SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|166364470|ref|YP_001656743.1| from Microcystis aeruginosa NIES-843

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|166364470|ref|YP_001656743.1|
Domain Number 1 Region: 140-358
Classification Level Classification E-value
Superfamily Nitrite and sulphite reductase 4Fe-4S domain-like 6.41e-55
Family Nitrite and sulphite reductase 4Fe-4S domain-like 0.00000536
Further Details:      
 
Domain Number 2 Region: 444-579
Classification Level Classification E-value
Superfamily Nitrite and sulphite reductase 4Fe-4S domain-like 7.46e-35
Family Nitrite and sulphite reductase 4Fe-4S domain-like 0.0000706
Further Details:      
 
Domain Number 3 Region: 8-139
Classification Level Classification E-value
Superfamily Nitrite/Sulfite reductase N-terminal domain-like 8.34e-30
Family Duplicated SiR/NiR-like domains 1 and 3 0.0055
Further Details:      
 
Domain Number 4 Region: 360-437
Classification Level Classification E-value
Superfamily Nitrite/Sulfite reductase N-terminal domain-like 8.5e-18
Family Duplicated SiR/NiR-like domains 1 and 3 0.0032
Further Details:      
 
Weak hits

Sequence:  gi|166364470|ref|YP_001656743.1|
Domain Number - Region: 608-643
Classification Level Classification E-value
Superfamily Ribbon-helix-helix 0.0126
Family PutA pre-N-terminal region-like 0.052
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|166364470|ref|YP_001656743.1|
Sequence length 645
Comment sulfite reductase subunit beta [Microcystis aeruginosa NIES-843]
Sequence
MVTTPISPTAKVSKVEGIKERSNYLREPLASELLEDTTHFTDAAVQILKFHGSYQQDNRD
NRAKGQEKDYQMMLRTRSPGGFIPAQLYLTLDSLSDRYGNGTLRVTTRQGFQLHGILKKN
LKATLGEIIRSMGSTLAACGDVNRNVTAPPAPYKNRPEYGYAWEYANNIADLLTPQTGAY
YEIWLDGEKVISAEEAPEVKAARQKDTNGINKNDPIEPIYGQHYMPRKFKMGVTVPGDNS
IDIYTNDIGLVVITDANGQLQGFNVLAGGGLGRTHNKEETFPRMADPIGYVDKEEVYDLV
KAIVATQRDYGDRGDRRHARMKYILEEWGVEKFRSTVEGYFGQKIAPYQPLPDWEYQDFL
GWNEQGDGKLFFGLSVENGRVKNEGSFQLKTALKVIIERFQLPMRLTANHNIILYEIEPQ
DQQAIEAILKEHGIITDPAEIDPLTRYAMACPAWPTCGLAITESERILPQVIERIRALLN
RLGLSKEQFVIRMTGCPNGCARPYMAELGFVGSAPNSYQLWLGGTADQTRLARPYLDKMA
IDDLEKVLEPIFVYFQQDQQNNETFGEFCHRVNFPALQAFSATYTPKMTETTTTESKPKR
VRKNQNRVSVPDDMFVRLKEASETEKRPMNQIINEALEAYFSQKS
Download sequence
Identical sequences A0A139GH03 B0JW71
gi|166364470|ref|YP_001656743.1| 449447.MAE_17290 WP_012265056.1.4043 WP_012265056.1.52201

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]