SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|166364511|ref|YP_001656784.1| from Microcystis aeruginosa NIES-843

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|166364511|ref|YP_001656784.1|
Domain Number 1 Region: 286-360
Classification Level Classification E-value
Superfamily Pentapeptide repeat-like 0.000000000000249
Family Pentapeptide repeats 0.0062
Further Details:      
 
Weak hits

Sequence:  gi|166364511|ref|YP_001656784.1|
Domain Number - Region: 63-131
Classification Level Classification E-value
Superfamily MFS general substrate transporter 0.0706
Family Glycerol-3-phosphate transporter 0.076
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|166364511|ref|YP_001656784.1|
Sequence length 420
Comment hypothetical protein MAE_17700 [Microcystis aeruginosa NIES-843]
Sequence
MSDRKDPEKLAAENRDDNPENNGKTSLSPPDASEYVSSLSSRNPVRQRILLLKDLRPGNA
GLLLAPLMVMTIGLVFSWDWLGFSGAIVAILISLQVILPSIRQWIAHYLTPSERQTVFAF
IVFIAALAALGKYLGVYERILRWLESFKYDEFGSWAEWVGALGQIMIAVLAVYVAWEQYV
ISKDLTIQQNRITQQQTIDSYFQGISDLALDEEGFLEDWPQERAIAEGRTASILSSVDAS
GKAKILRFLSQSRLLSPIKRDRYLGRPILDGEGGYAEDREFGTRVVQLGVMLAGSDISGQ
DLRWTDLSEANMVRADLSYSDLVKANVSRTILYEANLRGADMKGMRLFYGSLENATPRSR
SVPPNYDTGEHTGAVVENVNFTGVKNMSEEQRHYCCRWCGEKSRATIPGGCADIANLLGR
Download sequence
Identical sequences B0JWB2 I4I7D7
gi|166364511|ref|YP_001656784.1| 449447.MAE_17700 WP_002795670.1.4043 WP_002795670.1.50331

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]