SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|166364582|ref|YP_001656855.1| from Microcystis aeruginosa NIES-843

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|166364582|ref|YP_001656855.1|
Domain Number 1 Region: 135-299
Classification Level Classification E-value
Superfamily Nitrite and sulphite reductase 4Fe-4S domain-like 2.09e-46
Family Nitrite and sulphite reductase 4Fe-4S domain-like 0.00000409
Further Details:      
 
Domain Number 2 Region: 10-132
Classification Level Classification E-value
Superfamily Nitrite/Sulfite reductase N-terminal domain-like 8.18e-30
Family Duplicated SiR/NiR-like domains 1 and 3 0.00018
Further Details:      
 
Domain Number 3 Region: 392-503
Classification Level Classification E-value
Superfamily Nitrite and sulphite reductase 4Fe-4S domain-like 8.24e-30
Family Nitrite and sulphite reductase 4Fe-4S domain-like 0.00002
Further Details:      
 
Domain Number 4 Region: 272-404
Classification Level Classification E-value
Superfamily Nitrite/Sulfite reductase N-terminal domain-like 8.01e-24
Family Duplicated SiR/NiR-like domains 1 and 3 0.00014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|166364582|ref|YP_001656855.1|
Sequence length 513
Comment ferredoxin-nitrite reductase [Microcystis aeruginosa NIES-843]
Sequence
MVQAPEKDGTTLNKFEKFKAEKDGLAIKDELDHFAQIGWEAMDKTDLEHRLKWVGVFYRP
VTPGKFMMRLRVPNGILSSEQMRVLGEIVQRYGDDGNADITTRQNLQLRGIRIEDIPDIF
QRLKSVGMTSVQSGMDNVRNITGSPMAGLDADELIDTRELVQKVQDMITNYGEGNYQFSN
LPRKFNIAIEGGRDNSVHAEINDIAFVPAYKEGELGFNVVVGGFFSAKRCEAAIPINVWV
RPNQEVVDLCRAILEVYRDNGLRANRQKSRLMWLIDEWGIEEFRTRVANQLGYPLATAAE
KDAIDWEKRDHLGVFPQKQEGLSYIGFCVPVGRLFADDMFDLARIAEVYGSGELRLTVEQ
NVIIPNIAAENMPTLLSEPLLAKFTPNPTPLQRALVSCTGAQFCNFALIETKNRAVDLIS
QLDAELNIPRGVRIHWTGCPNSCGQPQVADIGLMGTKARKDGKTVEGVDLYMGGKVGKDA
HLGSCVQKGIPCEDLKSVLTSILIEQFGATPKG
Download sequence
Identical sequences B0JWI3
WP_012265139.1.4043 449447.MAE_18410 gi|166364582|ref|YP_001656855.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]