SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|166364603|ref|YP_001656876.1| from Microcystis aeruginosa NIES-843

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|166364603|ref|YP_001656876.1|
Domain Number 1 Region: 263-521
Classification Level Classification E-value
Superfamily PP2C-like 6.02e-47
Family PP2C-like 0.00011
Further Details:      
 
Weak hits

Sequence:  gi|166364603|ref|YP_001656876.1|
Domain Number - Region: 18-49
Classification Level Classification E-value
Superfamily NOB1 zinc finger-like 0.0798
Family NOB1 zinc finger-like 0.013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|166364603|ref|YP_001656876.1|
Sequence length 668
Comment putative protein phosphatase [Microcystis aeruginosa NIES-843]
Sequence
MDSVTTLQCQNLTCLSPNALTNRFCEKCGTPLVKRYLWMMGDWVRTYYHVGELIDNRYLV
KQPQIVLDTKPAQAPQAPDEPPSWISLYLKLLPFHLHIPQVYGYIPSPDEPLNMDIWLLE
YGTIPLDQTGELIYPELLPTLAEVWSQASDLRQIHWLWQMAKLWHPLQKKALVSSLLNPF
LTRVNNQLLQLLELSKDEATAPNLKDLGAFWTGLIPTAAANIQDFLVSLTQELESGDLDR
PESLIAILDYALQHYGGGQERTYEIFTCTDTGLMREHNEDACYPPTNQAITLAHGQNPLA
IVCDGIGGQEGGEIAAQLAIETLPREINRSATTDMEVYPDSHSLVLEQAIRVINDLISQR
NDQESRQDRQRMGTTLVMAFAQAQEMYAAHVGDSRIYWITAHSCHQVTVDDDLASREVKL
GYLLYRDAIQYPNAGVLVQALGMSSANNLHPTVQRLIIDQDCVFLLCSDGLSDYDRVEQY
WDSEIVPLLRGEKNVTAVGESLLQLANQKNGHDNSTIALVYCRVVPAAEPVTPLVYAEAK
ERIIPDLNDQDFDHSGDTYPGEEVVTAIPTPPPASSSVSSRTSPPALTRVSPLVVVAIAV
GVLGLLAAIAWQFLSRHPASNPSISPAPVTSPSPTTGTTPSAPVTSPTTGTTPSAPVTSP
TPPNASPN
Download sequence
Identical sequences B0JWK4
WP_012265152.1.4043 gi|166364603|ref|YP_001656876.1| 449447.MAE_18620

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]