SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|166364684|ref|YP_001656957.1| from Microcystis aeruginosa NIES-843

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|166364684|ref|YP_001656957.1|
Domain Number 1 Region: 195-672
Classification Level Classification E-value
Superfamily (Trans)glycosidases 1.75e-98
Family Amylase, catalytic domain 0.0000000854
Further Details:      
 
Domain Number 2 Region: 27-154
Classification Level Classification E-value
Superfamily E set domains 8.75e-34
Family E-set domains of sugar-utilizing enzymes 0.0001
Further Details:      
 
Domain Number 3 Region: 704-784
Classification Level Classification E-value
Superfamily Glycosyl hydrolase domain 0.00000000000000863
Family alpha-Amylases, C-terminal beta-sheet domain 0.0088
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|166364684|ref|YP_001656957.1|
Sequence length 789
Comment isoamylase [Microcystis aeruginosa NIES-843]
Sequence
MLPAIGQNHPQSGNYAPLDSHLWADATYPLGAHYRGDSVTFAVYSRNASQILLEIYDRPT
GENAKYDYWLTKNPNDDIWRAKIAGIAHGSYYAFRCWGPNWQFDQKWQRGHSNAGFRADV
DDFGHRFNPNKVLFDPYARELSQDIETPAMVAAGENVGIYATGGGDYKGVIQRQYDTGKW
SPKGIVIAPDGTSTGIRPRLGAEKAIIYEAHVRGLSNHPSASRLEDILKGIRGFEEVANV
PDRYRGTYAGAGYMAKYLKALGFTTIELLPVQETANDNNPDDRPSGNYWGYMTFGYFAPD
RRYAYDRSPGGPTREFKAMVKAFHDQGMEVYLDVVYNHTGEGGNWGSNDVTGFVSFGGFD
VVEYYQLTDEHYLVDGATGCGNQLNFSHIVTCNLVLDSLTYWLETMGVDGFRFDLAPVLG
RTPSSHQREDRGKQKQFFPKHTLLEKIEKLGKKYDAEMIAEAWDSWGYEVGNFPTGWGEW
NGRYRDAIRRFLKGDGNTFKFIEQVNGDYHNFNDQGGPEKSIDFIVAHDGFTLMDLVSYN
SKNNLTPWPFGPSDGGNSNNDSCDSGGDQALRRQRLRNFWTIQFLSRGVPMTVWGDEFGR
SQNGNNNPYNIDSVATWNNYDMIATRSPHLLPTGYREAYHNNFGTGTNQEERNPLFIFAA
YIAHLRQNHTALKQRHYGDMVLDASNDVTYLFKKTDGVSDLTADDRCIWFLIDGSAVGDH
DFLVLINMYHLPVDFRLPSSSNNYRWLRIIDTAAWAETDYNCWSVDQGTVIADNYQVNGF
SIVVCQEIN
Download sequence
Identical sequences B0JXD8
gi|166364684|ref|YP_001656957.1| 449447.MAE_19430 WP_012265211.1.4043

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]