SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|166364891|ref|YP_001657164.1| from Microcystis aeruginosa NIES-843

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|166364891|ref|YP_001657164.1|
Domain Number 1 Region: 18-189
Classification Level Classification E-value
Superfamily NAD(P)-binding Rossmann-fold domains 1.32e-38
Family Glyceraldehyde-3-phosphate dehydrogenase-like, N-terminal domain 0.0042
Further Details:      
 
Domain Number 2 Region: 139-318
Classification Level Classification E-value
Superfamily Glyceraldehyde-3-phosphate dehydrogenase-like, C-terminal domain 0.00000000000000419
Family Glucose 6-phosphate dehydrogenase-like 0.0098
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|166364891|ref|YP_001657164.1|
Sequence length 357
Comment putative oxidoreductase [Microcystis aeruginosa NIES-843]
Sequence
MSNQPANFPGNRNQLKPIKVGIIGVGNMGQHHSRILSLLKDVEFVGVADVNVEKGLETAS
KYRVRFFENYLDLLPRVDAVCIAVPTRLHHRVGMDCLQGGVHTLIEKPIAASISEAESLV
NAAADHDCILQVGHIERFNPAFQELSKVLKTEEILAIESHRMSPYSQRANDVSVVLDLMI
HDIDLILELVSAPVVKLTASGSRAATDSGYLDYVTATLGFSNGVVANLTASKVTHRKIRR
LAAHCKNSLTEADFLNNEILIHRQTTANYSTDYGQVLYRQDGLIEKVYTSNIEPLHAELE
HFVHCVRGGDQPSVGGEQALKALRLASLIEQIALDGRVWQQSDWNYQYLNSPVITAS
Download sequence
Identical sequences B0JFW7
WP_012265360.1.4043 gi|166364891|ref|YP_001657164.1| 449447.MAE_21500

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]