SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|166365056|ref|YP_001657329.1| from Microcystis aeruginosa NIES-843

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|166365056|ref|YP_001657329.1|
Domain Number 1 Region: 104-316
Classification Level Classification E-value
Superfamily Glutathione synthetase ATP-binding domain-like 2.47e-53
Family BC ATP-binding domain-like 0.00000361
Further Details:      
 
Domain Number 2 Region: 1-102
Classification Level Classification E-value
Superfamily PreATP-grasp domain 5.9e-34
Family BC N-terminal domain-like 0.0000672
Further Details:      
 
Domain Number 3 Region: 325-418
Classification Level Classification E-value
Superfamily Rudiment single hybrid motif 1.41e-31
Family BC C-terminal domain-like 0.00031
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|166365056|ref|YP_001657329.1|
Sequence length 421
Comment phosphoribosylamine--glycine ligase [Microcystis aeruginosa NIES-843]
Sequence
MKIIVIGSGGREHALAWKLLQSPEVEQVFCIPGNGGTAILPQCENIPIAMEDFAEISRFA
RENCVDLVVVGPEYPLSLGITDHLLGQEIAVFGPTQTGALIESSKSWAKELMSEAAVITA
VSETFTDAELAKTYIREQGAPIVVKADGLAAGKGVIVAETVDTALEAIDDLFTGGFTKVV
VEEFLEGEEVSILTLTDGISFRSLLPAQDHKRIGEGDTGKNTGGMGVYAPAPIATAAIIE
AVNRDILAPIVATLQKRGIDYRGVLYAGLMISPAGEPKVLEFNCRFGDPETQAVLPLLET
PLAPLLLACAQQKLTDFPSLQWRSGSAVCVVAASAGYPDHYEKGQLITGIKAAETAGAIV
FHAGTVLKHGDIFTDGGRVLGVTAMGANFNQAIELAYQSVKRIHFQGIYYRRDIGHRVRE
K
Download sequence
Identical sequences B0JGD2
449447.MAE_23150 gi|166365056|ref|YP_001657329.1| WP_012265484.1.4043

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]