SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|166365070|ref|YP_001657343.1| from Microcystis aeruginosa NIES-843

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|166365070|ref|YP_001657343.1|
Domain Number 1 Region: 17-502
Classification Level Classification E-value
Superfamily ADC synthase 9.81e-153
Family ADC synthase 0.000000259
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|166365070|ref|YP_001657343.1|
Sequence length 506
Comment anthranilate synthetase alpha-subunit [Microcystis aeruginosa NIES-843]
Sequence
MIFPDFDRFRQLAGQGNFIPVYQEWIADLETPVSAWYKVCANQAYNFLLESVEGGETLGR
YSFLGGDPVWVLEARGNTTTQTFRDGSQEIFSGDPFEILTQCLAPIVPVKLPQLPAGIGG
LFGFWGYELINWIEPRVPIYAATDADLPDGIWMQVDNLIIFDQVKRKIWAIAYADIRGKN
PDLAAAYQAACDRVTQLVLKLRLPLPTNAKTLELLPVGQGKELVYESNTTQEKFCQNVLK
AKDYIKAGDIFQVVISQRLNANYQGHPFDLYRSLRLINPSPYMAFYNFKDWQIIGSSPEV
MVKAERDELGKIKATVRPIAGTRRRGQNFSEDQALATDLLQDPKEIAEHIMLVDLGRNDL
GRVCDRGTVKVDELMIIERYSHVMHIVSNVVGDLATNKSAWDLLKACFPAGTVSGAPKIR
AMEIIHELEPCRRGPYSGVYGYYDFEGQLNSAITIRTMIVRPQGNQNYLVSVQAGAGLVA
DSEPEKEYEETLNKARGLLEAIRCLS
Download sequence
Identical sequences B0JGZ9 I4HQ45
449447.MAE_23290 gi|166365070|ref|YP_001657343.1| WP_012265493.1.4043 WP_012265493.1.50331

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]