SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|166365078|ref|YP_001657351.1| from Microcystis aeruginosa NIES-843

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|166365078|ref|YP_001657351.1|
Domain Number 1 Region: 809-1033
Classification Level Classification E-value
Superfamily Multidrug efflux transporter AcrB transmembrane domain 6.41e-46
Family Multidrug efflux transporter AcrB transmembrane domain 0.00011
Further Details:      
 
Domain Number 2 Region: 296-500
Classification Level Classification E-value
Superfamily Multidrug efflux transporter AcrB transmembrane domain 3.27e-35
Family Multidrug efflux transporter AcrB transmembrane domain 0.00017
Further Details:      
 
Domain Number 3 Region: 44-138
Classification Level Classification E-value
Superfamily Multidrug efflux transporter AcrB pore domain; PN1, PN2, PC1 and PC2 subdomains 2.88e-17
Family Multidrug efflux transporter AcrB pore domain; PN1, PN2, PC1 and PC2 subdomains 0.0027
Further Details:      
 
Domain Number 4 Region: 139-185,273-331
Classification Level Classification E-value
Superfamily Multidrug efflux transporter AcrB pore domain; PN1, PN2, PC1 and PC2 subdomains 4.45e-16
Family Multidrug efflux transporter AcrB pore domain; PN1, PN2, PC1 and PC2 subdomains 0.011
Further Details:      
 
Domain Number 5 Region: 725-809
Classification Level Classification E-value
Superfamily Multidrug efflux transporter AcrB TolC docking domain; DN and DC subdomains 0.000000000000051
Family Multidrug efflux transporter AcrB TolC docking domain; DN and DC subdomains 0.0088
Further Details:      
 
Domain Number 6 Region: 187-271
Classification Level Classification E-value
Superfamily Multidrug efflux transporter AcrB TolC docking domain; DN and DC subdomains 0.000000000196
Family Multidrug efflux transporter AcrB TolC docking domain; DN and DC subdomains 0.0073
Further Details:      
 
Domain Number 7 Region: 572-660
Classification Level Classification E-value
Superfamily Multidrug efflux transporter AcrB pore domain; PN1, PN2, PC1 and PC2 subdomains 0.00000000602
Family Multidrug efflux transporter AcrB pore domain; PN1, PN2, PC1 and PC2 subdomains 0.007
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|166365078|ref|YP_001657351.1|
Sequence length 1034
Comment multidrug efflux transporter [Microcystis aeruginosa NIES-843]
Sequence
MSENISLSGLSIRRHIGVLMLTIAVIIIGLFFLNRLEVDLLPSITYPRISLRMNVPGVSP
EVILEEVTKPLEEGMSATEGVVQVYSETREGRMRVDLFFQPGGDLNVALNEATESFNRVR
QNLPDIIEEPRLNKFEPSRLPVYEFAVVSDTLPLKDLRLFADEELGRELGFVEGVAVVDV
IGGVREEIQVNIDLQRLQSLGVGLNQVLDTLKRRNQDISGGRLEGETGEPLTRAVGKFKN
VADIQDLALTDSNNPEEKIYLRDVARVIDGTEEQRIFVTLNGKNAVRVSVQKQPNANTIA
VVEGVKKRITELKKSGLMTGGIQVVPTTDESVFIQNAVNNVVSSGLAGTILAGLTVFVFL
GSLRQTFIITLAIPLSTLVAIICMKLFGLSINVFSLGGLALGVGIVVDNSIVMLENIALK
VNQNQNKQDFLEIARNSSQEVESALLASTATNLVSILPFLLLGGFISLLFNEIILTISFA
VAASLLCALTVVPMLASRLLNMQVSSGIHRFWLLRVFSQRLEGLTILYGRFLAKIIHYRI
PVILLAFLILGGSSFYLWQYIPQEVFSRIQTGQVNVFAQFPPGTNLNTNRQVMREVEKIL
LSQPETEYVFTTSGGSLFGTTTNENILRASSTINLKKGTNTEAYIERMSKALEQLNLVNV
RLRLTPGQVRGIILNNSPSVGADVDVMLQGRDGKTLEQAGEEILSILDEKVPSARFRADA
DPRQPEIQIKPDWTRLNSLGLSTLEVGQTLRTAIQGSIPTQLQRGERLIDIRVQLDPNSR
QKISDISQIPIFVNRQEDLKLADIARIEGGKTPGVIQRINQRQVFIIIGSLVEGAKLSDA
LAGVQSLLNSTPLPDGISILPSAAATSNQEIQGSLGLLAGLSVFLVFVVMAVQYNSLIDP
LVIMLTVPLALAGGIFGLYWTKTPINAIVIVGVVLLVGIVVNNGIIMVELANQLRQEFGF
TRLQAILKAAPQRLRPILMTTVTTVLGLFPLALGLGEGGQFLQPLGIVVFSGLSLATLLT
LFIIPCFYVLFSRK
Download sequence
Identical sequences B0JH07
gi|166365078|ref|YP_001657351.1| WP_012265498.1.4043 449447.MAE_23370

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]