SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|166365279|ref|YP_001657552.1| from Microcystis aeruginosa NIES-843

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|166365279|ref|YP_001657552.1|
Domain Number 1 Region: 15-242
Classification Level Classification E-value
Superfamily Undecaprenyl diphosphate synthase 5.62e-92
Family Undecaprenyl diphosphate synthase 0.000000819
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|166365279|ref|YP_001657552.1|
Sequence length 249
Comment undecaprenyl pyrophosphate synthase [Microcystis aeruginosa NIES-843]
Sequence
MTLKPSLSPELPTDLDKNRLPQHVAVIMDGNGRWAKNRGLPRIMGHQRGVDALKDLLRCC
RDWGIPALTAYAFSTENWGRPLEEVEFLMTLFERVLRRELEEMMQQNVKIRFIGNLSALP
ESLRREIAKSQAETSKNSGIQFTVATNYGGREEIVQACQAIARQVQQGLVSPEAIDESLF
EQYLYTAGIPNPDLLIRSSGEMRISNFLLWQMAYAEIYVTDTLWPDFDRVQFHRALKDYQ
GRHRRFGKL
Download sequence
Identical sequences B0JI62 I4I3G1
gi|166365279|ref|YP_001657552.1| WP_002799081.1.4043 WP_002799081.1.50331 449447.MAE_25380

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]