SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|166365353|ref|YP_001657626.1| from Microcystis aeruginosa NIES-843

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|166365353|ref|YP_001657626.1|
Domain Number 1 Region: 4-359
Classification Level Classification E-value
Superfamily Dehydroquinate synthase-like 1.7e-112
Family Dehydroquinate synthase, DHQS 0.00000767
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|166365353|ref|YP_001657626.1|
Sequence length 366
Comment 3-dehydroquinate synthase [Microcystis aeruginosa NIES-843]
Sequence
MAICIPVNLPDRSYNILIEKGSLANLGGEMSQLSLGKKVLLVSNPEIFDYYGQIAVNSLE
KAGFAVFTHLIPAGENYKTLDAIAQVYDSALAHRLERSSTMVALGGGVIGDMTGFAAATW
LRGVNFVQVPTTLLAMVDASIGGKTGVNHPQGKNLIGAFYQPKLVLIDPDVLKTLPVREF
RAGMAEVIKYGVIWDAELFQQLEDSDNLASFSQIDGELLQTIITKSCQAKADVVSKDEKE
AGLRAILNYGHTIAHGIESLTGYTSVNHGEAVALGMVAAGAIAVKLGMWTAGENQRQTDL
IEKAALETRMPPLNADEMVNALTADKKVKDGQVRFILPTAIGQVTISDRVTPTLVREVLS
PTESGQ
Download sequence
Identical sequences B0JID6
gi|166365353|ref|YP_001657626.1| 449447.MAE_26120 WP_012265710.1.4043

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]