SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|166365472|ref|YP_001657745.1| from Microcystis aeruginosa NIES-843

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|166365472|ref|YP_001657745.1|
Domain Number 1 Region: 32-221
Classification Level Classification E-value
Superfamily PHP domain-like 1.41e-38
Family PHP domain 0.008
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|166365472|ref|YP_001657745.1|
Sequence length 227
Comment hypothetical protein MAE_27310 [Microcystis aeruginosa NIES-843]
Sequence
MVVSATIPPLAQDTLALKAVWANVGYDSCPYHYNFHLHTHCSDGQMSPQDLMRQALDIGL
KGLAITDHHSIEGYRQAQIWLENEHLKGSLPHLWTGVEITANLLETEVHILGYGFDPTHT
VLTPYLQRAKPEGDLALASRVINSLQQAGALVVLAHPFRYHRPAADLVAAAVELGIDGIE
AFYAYGNPKPWLPSQRETEQALALSRQYQLFATCSTDSHGKSLLQRI
Download sequence
Identical sequences B0JJB1 I4HGH8
gi|166365472|ref|YP_001657745.1| 449447.MAE_27310 WP_004162466.1.4043 WP_004162466.1.50331

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]