SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|166365565|ref|YP_001657838.1| from Microcystis aeruginosa NIES-843

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|166365565|ref|YP_001657838.1|
Domain Number 1 Region: 5-119
Classification Level Classification E-value
Superfamily CheY-like 0.0000000000327
Family CheY-related 0.017
Further Details:      
 
Weak hits

Sequence:  gi|166365565|ref|YP_001657838.1|
Domain Number - Region: 352-437
Classification Level Classification E-value
Superfamily FtsH protease domain-like 0.0523
Family FtsH protease domain-like 0.028
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|166365565|ref|YP_001657838.1|
Sequence length 548
Comment hypothetical protein MAE_28240 [Microcystis aeruginosa NIES-843]
Sequence
MIDRPLTLIIIDNDPIFRLGLVQALSQIENISIVTEGDLETIFALTLNPAPEIILIDPLF
DWSYCEILHSRYPESKIVLLTFPLDSRQQLIARELGIAGYIPKGTNLEQFITILGQISRD
ETHDVAPSALTIATRPSLAPSHWLITAGKTGLNRIESELHLIDLHLNQQSLSGFDRFYWQ
GRKRELLAALWLVRKLIPLEGSYYNSPSATPPIIINNIDRELPILSRERPLCVSAVFEST
LAVIRSPLINRTKISFEIDVLLDNRQRELLYLVLDEIRKNVDEMRYLQISSGELTSRLNL
IIYDIWEKVTRKFLEINASVYDEISKGRLNEIILEEREAIQTEILNKIPFTLDLFSYLVY
ENSLTIDGVGYRANAPETIARAEILLQNLIHNIANAVTVIILNNFSESERVKQKLYRSEF
LIARKLAKIRNELSWKYRRQQYWQDPKDIFESQYQLFHYSEGEIQSLAIYSPRQEELNSL
TGIPWLVSIALELRDSLSPRLRAFFRVVGKGVVYILIQVIGRGIGLVVRGVLQGVGNTWQ
EVKGKKGS
Download sequence
Identical sequences B0JJK4
WP_012265863.1.4043 gi|166365565|ref|YP_001657838.1| 449447.MAE_28240

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]