SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|166365764|ref|YP_001658037.1| from Microcystis aeruginosa NIES-843

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|166365764|ref|YP_001658037.1|
Domain Number 1 Region: 65-142
Classification Level Classification E-value
Superfamily Collagen-binding domain 0.00000981
Family Collagen-binding domain 0.014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|166365764|ref|YP_001658037.1|
Sequence length 153
Comment peptidase [Microcystis aeruginosa NIES-843]
Sequence
MTRFPLTGRYSGLCVLLTLFWLSGQSLPVRAEKIYNPLPLILNKEINDTLTDKDIPTGEG
GFARDYTVDLDKDDQVAIDLKSENFDGVLILLADDGSTVAENDDGPDGGTNALLFARITE
SGKYVIRVRAFGETGGGKFTLKLTRLRAVDGKN
Download sequence
Identical sequences B0JKQ6 I4FJU4 I4HWM3
gi|166365764|ref|YP_001658037.1| WP_002757946.1.24258 WP_002757946.1.4043 WP_002757946.1.50331 449447.MAE_30230

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]