SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|166366048|ref|YP_001658321.1| from Microcystis aeruginosa NIES-843

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|166366048|ref|YP_001658321.1|
Domain Number 1 Region: 16-69
Classification Level Classification E-value
Superfamily Rubredoxin-like 2.02e-21
Family Rubredoxin 0.0016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|166366048|ref|YP_001658321.1|
Sequence length 115
Comment membrane-associated rubredoxin [Microcystis aeruginosa NIES-843]
Sequence
MSDRPPELTLADQAPANYECRSCGYVYDPSKGDSKTNTPAGTPFEELPETWRCPVCGVRR
SQFINIGAKDAPSGFQENLSYGFGVNRLTPAQKNILIFGALALGFVFFISLYGLN
Download sequence
Identical sequences B0JLV5 I4FY25 I4GUP7 I4H358 I4HXX5 I4IEN2
gi|166366048|ref|YP_001658321.1| 449447.MAE_33070 WP_002757647.1.10452 WP_002757647.1.20667 WP_002757647.1.24258 WP_002757647.1.39664 WP_002757647.1.4043 WP_002757647.1.50331 WP_002757647.1.50673 WP_002757647.1.77316 WP_002757647.1.7764

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]