SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|166366248|ref|YP_001658521.1| from Microcystis aeruginosa NIES-843

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|166366248|ref|YP_001658521.1|
Domain Number 1 Region: 138-578
Classification Level Classification E-value
Superfamily (Trans)glycosidases 1.64e-126
Family Amylase, catalytic domain 0.00000076
Further Details:      
 
Domain Number 2 Region: 8-146
Classification Level Classification E-value
Superfamily E set domains 1.51e-39
Family E-set domains of sugar-utilizing enzymes 0.0035
Further Details:      
 
Domain Number 3 Region: 591-689
Classification Level Classification E-value
Superfamily Glycosyl hydrolase domain 8.63e-22
Family alpha-Amylases, C-terminal beta-sheet domain 0.007
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|166366248|ref|YP_001658521.1|
Sequence length 692
Comment glycogen operon protein GlgX-like protein [Microcystis aeruginosa NIES-843]
Sequence
MTLETDHGKSHPVGATVLADGVNFSLFSKYATAIELLLFDDANSPVPSRTILLTPQTNRT
FFYWHIFVHGIGAGQVYAYRVYGPDNPAQGHRFDPDKVVLDPYAKAIVGAEIYDRQAASE
KGDNCHRALRGLVVDTGRYDWEDDKPLRTPYSASFIYEMHVGGFTRNPNSGVSEEKRGTF
AGLIEKIPYLKNLGITAVELLPIHYFDPASAMPGLTNYWGYSTISFFAPHAGYSSDRSPL
GPLNEFRDLVKALHKAGIEVILDVVFNHTAEGDEIGPTLSFKGIDNRTYYILDAEDKSLY
SNYTGCGNTLKGSHPIVGKMILDCLRYWVSEMHVDGFRFDLAAVLSRNVDGEPILQKGYN
MIWAIESDPVLAGTKLIAEAWDAAGLYSVGQFVEFADWFSEWNGPFRDDVRAFVRGDTSI
VTKLAARILGSPDIYHRPDTDVNRSINFVTCHDGFTLNDLVSYDGKHNEANGEENRDGCN
DNFSWNCGVEGETNNEAIKTLRLQQIKNLLTILFISQGTPMLLMGDEVRRTQKGNNNAYC
QDNQLSWFDWSAVEQEFDLWCFVRRLIDFNKKLALFRQEKLLEVTYTSLEPHLSWHGVQL
SKPDWSEDSRSLAFSLRHPKANEYLHIMLNAYWESLNFQLPPLFPEEKWHRVIDTAGQLS
EAACDLDAAVAIESETYRVQARSAVVLIVKPV
Download sequence
Identical sequences B0JMP4
WP_012266377.1.4043 gi|166366248|ref|YP_001658521.1| 449447.MAE_35070

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]