SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|166366250|ref|YP_001658523.1| from Microcystis aeruginosa NIES-843

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|166366250|ref|YP_001658523.1|
Domain Number 1 Region: 146-422
Classification Level Classification E-value
Superfamily Enolase C-terminal domain-like 2.58e-126
Family Enolase 0.0000000278
Further Details:      
 
Domain Number 2 Region: 8-143
Classification Level Classification E-value
Superfamily Enolase N-terminal domain-like 4.15e-53
Family Enolase N-terminal domain-like 0.00000872
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|166366250|ref|YP_001658523.1|
Sequence length 432
Comment phosphopyruvate hydratase [Microcystis aeruginosa NIES-843]
Sequence
MLDKIEVPIEAIAAREILDSRGRPTIEAEVLLESGALGLAQVPSGASTGSFEAHELRDDD
PQRYGGKGVLKAVRNVHEKIVPVLEGMNAFDQASIDLAMIDRDGTANKRELGANAILAVS
LATAKAAAADLGLPLYRYLGGPMANVLPVPMMNVINGGSHADNNVDFQEFMIFPIGADSF
KEGLRWGAEVFAALGKALHERKLLTGVGDEGGYAPNLASNQEALDILIESIERAGYKPGS
QVALAMDVAASEFYRDGQYIYDGSAHSPAEMVDFLASLVERYPIISIEDGLHEEDWDNWK
LLTDKLGARIQLVGDDLMVTNPIRLQKAIDLGIANSILIKLNQIGSLTETLQTIALATRH
GYRSVISHRSGETEDTTIADLAVATNAGQIKTGSLSRSERVAKYNRLLRIEEELGDRAVY
APKVGLGPKFLA
Download sequence
Identical sequences B0JMP6
gi|166366250|ref|YP_001658523.1| 449447.MAE_35090 WP_012266379.1.4043

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]