SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|166366354|ref|YP_001658627.1| from Microcystis aeruginosa NIES-843

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|166366354|ref|YP_001658627.1|
Domain Number 1 Region: 306-506
Classification Level Classification E-value
Superfamily Multidrug efflux transporter AcrB transmembrane domain 7.59e-44
Family Multidrug efflux transporter AcrB transmembrane domain 0.0000081
Further Details:      
 
Domain Number 2 Region: 816-1048
Classification Level Classification E-value
Superfamily Multidrug efflux transporter AcrB transmembrane domain 1.83e-41
Family Multidrug efflux transporter AcrB transmembrane domain 0.0000196
Further Details:      
 
Domain Number 3 Region: 574-680
Classification Level Classification E-value
Superfamily Multidrug efflux transporter AcrB pore domain; PN1, PN2, PC1 and PC2 subdomains 6.54e-28
Family Multidrug efflux transporter AcrB pore domain; PN1, PN2, PC1 and PC2 subdomains 0.00027
Further Details:      
 
Domain Number 4 Region: 157-191,284-340
Classification Level Classification E-value
Superfamily Multidrug efflux transporter AcrB pore domain; PN1, PN2, PC1 and PC2 subdomains 1.2e-20
Family Multidrug efflux transporter AcrB pore domain; PN1, PN2, PC1 and PC2 subdomains 0.0026
Further Details:      
 
Domain Number 5 Region: 44-134
Classification Level Classification E-value
Superfamily Multidrug efflux transporter AcrB pore domain; PN1, PN2, PC1 and PC2 subdomains 3.14e-20
Family Multidrug efflux transporter AcrB pore domain; PN1, PN2, PC1 and PC2 subdomains 0.00022
Further Details:      
 
Domain Number 6 Region: 731-815
Classification Level Classification E-value
Superfamily Multidrug efflux transporter AcrB TolC docking domain; DN and DC subdomains 9.68e-19
Family Multidrug efflux transporter AcrB TolC docking domain; DN and DC subdomains 0.001
Further Details:      
 
Domain Number 7 Region: 192-282
Classification Level Classification E-value
Superfamily Multidrug efflux transporter AcrB TolC docking domain; DN and DC subdomains 1.23e-18
Family Multidrug efflux transporter AcrB TolC docking domain; DN and DC subdomains 0.00038
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|166366354|ref|YP_001658627.1|
Sequence length 1100
Comment RND multidrug efflux transporter [Microcystis aeruginosa NIES-843]
Sequence
MILSIADTFIKRPVLTTVCSILIVLIGAIAVPFLPLEKLPQLAFIQVAVNANYLGTDAKT
VQDNVTTVLDRQINGTEQIVYMQSQSTNTGQSTVNVFFPVEMDRNIAQVLVQNRVSTAAA
SLPEEVNRQGVTTNTQSPSVTLAYGISAKPDEKGNYPYDTVFLSNFVDRVIDAEIRRIEG
VGSTTIIGEREYALRFWLNPDALAARGVSAEQVVQAIREQNIQVGAGTIGGDPSPEEQQF
QIAIRAVGRVATGEEAENIVVKVGENGDLIRIKDVGRAEIGAESYSTAAYFDKSPAVVYI
VYQLPGSNAWNTAKLVKEKMAELEPSFPPGLNIAITLDNTAFVAASLEEAFSTLVEAILL
VILVIFIFLQDWRTTIIPAIAIPVSLIGTMAVALALGYSLNNLSLFAVILATGLVVDDGI
VIVEAVSEKLRQGMRPFQAALDAMGELTSAVIASSLVLLAVFIPVTFFPGTVGIVYRQFA
VIISASIIISTFNALSFSPTMSAIIMKAPQRTRGPLGLFFEGFNRGFNAVKEGYRRSIEF
LIRIRFLVLPFFIAALFLTAWSYSTTPQGFIPEEDQGYAFVLVQAPPGVSLRYTDQVIRQ
INEEILDGIEEIEHFVGMAGFSFAGSGSNQGLFFVKLKEWSERPGEDKSVFGVLRKINQQ
LATKVPDARAFAVNAPPVDGLSSTGGFELFIQNRASFPMDALIANANKVMAEARTRPELS
GIFTQFTTDTPMLELSINRNQLQAQNVDMQAVFGTLQTYLGSNFVNQFVLGDRLYRVFAQ
AEADYRSNPEDINRLYVRSRTGANIPLSGLVSVKRFTYPPIITNFNLYPSINVQGSPAPG
FSTGQAIAVMEDVCRKVLQPGFGYAWTGTAFQEKTSAGAAPVIFGLAFIVVFLVLAAQYE
SYIDPIIIMITVPLAILGAMGALLLRANFLQVGSLFPAVNNNIYAQVALVMLIGLAAKNA
ILIVEFANQSRTLGLSIPDAAARASTERLRPILMTAISGLVGFLPLVIASGAGAMSRWSL
GTAILGGYLISTVLSLFLVPVLYVLIKQFEARFLSSKPPKSGGSGGKKTPSLDGERNTSE
TPIEEGAISSLKISPQSPND
Download sequence
Identical sequences B0JNK5
WP_012266447.1.4043 gi|166366354|ref|YP_001658627.1| 449447.MAE_36130

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]