SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|166366402|ref|YP_001658675.1| from Microcystis aeruginosa NIES-843

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|166366402|ref|YP_001658675.1|
Domain Number 1 Region: 21-140
Classification Level Classification E-value
Superfamily N-utilization substance G protein NusG, N-terminal domain 1.28e-31
Family N-utilization substance G protein NusG, N-terminal domain 0.00012
Further Details:      
 
Domain Number 2 Region: 133-204
Classification Level Classification E-value
Superfamily Translation proteins SH3-like domain 2.71e-18
Family N-utilization substance G protein NusG, C-terminal domain 0.0015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|166366402|ref|YP_001658675.1|
Sequence length 205
Comment transcription antitermination protein NusG [Microcystis aeruginosa NIES-843]
Sequence
MNLEEEQFPEEVNLSNLPKKPRWYAVQVASGCEKRVKANLEQRIHTLDVADRILQVQIPQ
AATVKVRKDGSRQHGEEKVFPGYVLIKMIMDDDAWQVVKNTPHVINFVGAEQKRHYGRGR
GHVTPLPLSMSEVDRIFKQAQIQEPVVKINMEVGDQILVLSGPFKDFEGEVIEVSPERGK
LKALLSIFGRDTPVELEFNQVEKQN
Download sequence
Identical sequences A0A139GLR1 B0JNQ3 I4HQS7
449447.MAE_36610 WP_002796880.1.4043 WP_002796880.1.50331 WP_002796880.1.52201 gi|166366402|ref|YP_001658675.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]