SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|166366475|ref|YP_001658748.1| from Microcystis aeruginosa NIES-843

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|166366475|ref|YP_001658748.1|
Domain Number 1 Region: 782-1006
Classification Level Classification E-value
Superfamily Multidrug efflux transporter AcrB transmembrane domain 5.1e-44
Family Multidrug efflux transporter AcrB transmembrane domain 0.00011
Further Details:      
 
Domain Number 2 Region: 294-490
Classification Level Classification E-value
Superfamily Multidrug efflux transporter AcrB transmembrane domain 1.96e-42
Family Multidrug efflux transporter AcrB transmembrane domain 0.0000842
Further Details:      
 
Domain Number 3 Region: 42-134
Classification Level Classification E-value
Superfamily Multidrug efflux transporter AcrB pore domain; PN1, PN2, PC1 and PC2 subdomains 5.23e-24
Family Multidrug efflux transporter AcrB pore domain; PN1, PN2, PC1 and PC2 subdomains 0.002
Further Details:      
 
Domain Number 4 Region: 140-183,269-322
Classification Level Classification E-value
Superfamily Multidrug efflux transporter AcrB pore domain; PN1, PN2, PC1 and PC2 subdomains 6.38e-17
Family Multidrug efflux transporter AcrB pore domain; PN1, PN2, PC1 and PC2 subdomains 0.0056
Further Details:      
 
Domain Number 5 Region: 184-266
Classification Level Classification E-value
Superfamily Multidrug efflux transporter AcrB TolC docking domain; DN and DC subdomains 0.00000000000000222
Family Multidrug efflux transporter AcrB TolC docking domain; DN and DC subdomains 0.014
Further Details:      
 
Domain Number 6 Region: 553-642
Classification Level Classification E-value
Superfamily Multidrug efflux transporter AcrB pore domain; PN1, PN2, PC1 and PC2 subdomains 0.00000000000000732
Family Multidrug efflux transporter AcrB pore domain; PN1, PN2, PC1 and PC2 subdomains 0.0042
Further Details:      
 
Domain Number 7 Region: 695-784
Classification Level Classification E-value
Superfamily Multidrug efflux transporter AcrB TolC docking domain; DN and DC subdomains 0.000000000000968
Family Multidrug efflux transporter AcrB TolC docking domain; DN and DC subdomains 0.012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|166366475|ref|YP_001658748.1|
Sequence length 1021
Comment RND multidrug efflux transporter [Microcystis aeruginosa NIES-843]
Sequence
MAFNISNWSIKNPIPTILISLVMALMGYIAFLGLGIDRSPNIDIPAVIITVNQPGAGPEE
LETQVTKKVEDAVAALGNIDQITSTINEGSSTTTVNFILGTNSDRATNDVRNAIAQIRQD
LPQDANDPIVQRLEFAGGAVMNYTISSPKRSIAELSDLVDRQIGRALTGVPGVARVDRVG
GVDREVRVDLDPGRLIAYGITATAVNDQIRSFNINLPGGRSEIAGSEQTVRTLGSAETIE
DLRNYQISLPNGDTVPLSNLGTVRDSSSDPRQMALLDGQPVVGFSILRGTGSTLVTVETA
VRQEIENLKKKLPEDIKFQLIFTRADSIRASYESLLSDLLIGCMMTVITVGLFLGNWRAT
IITGLALPLSIFPTFWVMQSLNYTLNGMTLLALALALGNLVDDAVCMVEDIDQHLAMGKK
PLQAAFDASKEIGLAVLASAAAIIAVFLPVAFMGGVPGQFFQPFGVTVAVSTLFSSLIAV
TVTPMLSAYILQPKKLKTGDGNPSSLPRFRPYKSLLTWSLRHRILTLLAALAFFIGSLQL
VPLIPKGLFSSGDTGLSTISLELPPGATLNDTVAVANQVNSLLQKNTAVANVLAIPGDSG
RVNTGLIYVNLVPKEQRSLTQRQFEEQTRLDFQKIPGARVSFRAQGGAGSTKDVAIILKS
ENGDILTQTAQKLEREMRALPGFVEVSSGVSLVKPELIIQPDPVRAADQGVSVRAIARTA
SLALIGDNEFNLAKFNLADRQIPIRVKIANDGRSEIETLQNLRVPSSNGTLVPLNSVATI
SLGSGPAEIQRFNRQRQVNIGANLEGVSLGSAVTQIRALPTMKNLPPEVTEEPFGDARIM
RDIFARFLGALSLAIISIYGILVLLYNNFLYPLAILTSLPLSIGGTLIALLITQKELGLY
ALIGIVLLMGLVTKNAILLVDFALSGIEAGKPQFQAMIDSGVSRLRPIIMTSVSTIAGML
PIALALGADGEIRAPMAIAVIGGFTTSTLLTLVVVPVIFTYIDSFYYWLRGLFVKQKPKS
I
Download sequence
Identical sequences B0JNX6
449447.MAE_37340 gi|166366475|ref|YP_001658748.1| WP_012266539.1.4043

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]