SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|166366603|ref|YP_001658876.1| from Microcystis aeruginosa NIES-843

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|166366603|ref|YP_001658876.1|
Domain Number 1 Region: 7-118
Classification Level Classification E-value
Superfamily Aspartate/glutamate racemase 2.62e-18
Family Aspartate/glutamate racemase 0.00063
Further Details:      
 
Domain Number 2 Region: 125-225
Classification Level Classification E-value
Superfamily Aspartate/glutamate racemase 0.00000000000327
Family Aspartate/glutamate racemase 0.0015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|166366603|ref|YP_001658876.1|
Sequence length 251
Comment McyF protein [Microcystis aeruginosa NIES-843]
Sequence
MKTKLPILGVLGGMGPVVTAEFLKSIYEYNPFIDKEQESPNVIVFSFPSAPDRTGSIDSG
KEREFIDFIQVNLEHLNKLADCIVIGCCTAHYALPQISENLKDKLLSLIKIADQELQEYN
EPTLLLASTGTYQKKLFQEGCTTADLIISLSESDQKLIHEMIYKVLKRGHDPLSILRDIE
ALLEKYNTRSYISGCTEFHLLTKSLKLKGIDSIKAIDPLSTIAQNFSQLIIKQAQVDRGT
DCHQPSTPKSP
Download sequence
Identical sequences B0JPW0 I4HRS3 J9WLP2 J9WLQ3
WP_002797059.1.4043 WP_002797059.1.50331 gi|166366603|ref|YP_001658876.1| 449447.MAE_38620

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]