SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|166366657|ref|YP_001658930.1| from Microcystis aeruginosa NIES-843

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|166366657|ref|YP_001658930.1|
Domain Number 1 Region: 4-227
Classification Level Classification E-value
Superfamily PHP domain-like 6.08e-34
Family PHP domain 0.017
Further Details:      
 
Domain Number 2 Region: 775-857
Classification Level Classification E-value
Superfamily Hedgehog/intein (Hint) domain 0.00000000000000235
Family Intein (protein splicing domain) 0.022
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|166366657|ref|YP_001658930.1|
Sequence length 874
Comment DNA polymerase III subunit alpha [Microcystis aeruginosa NIES-843]
Sequence
MSFVGLHIHSDYSLLDGASQLPALIDRAIELGQPAIALTDHGVMYGAIELIKTCRNKGIK
PIIGNEMYVVNGDIEVNLRHRKYHQVVLAKNTQGYKNLVKLTTISNLKGIQGKGIFARPC
INKELLQQYHEGLIVTSACLGGEIPQAILANNRKLAKETAKWYKKLFGDDFYLEIQDHGS
KEDRIVNVEIVKIAKELGIKVVATNDSHFISCYDVEAHDALLCIQTAKLITEDKRLRYSG
TEYLKSADEMRLLFRDHLPEDVIEEAINNTLEVAEKVEPYNIFNEPRLPNYPVPAGHTAD
SYVEEIAWLGLLERLKCPSRHEIEPVYKERLEYELKMLQKMGFSTYFLVVWDYIKYARDH
DIPVGPGRGSAAGSLVAYSLKITNIDPVHHGLLFERFLNPERKSMPDIDTDFCIERRDEM
IQYVTEKYGEANVAQIITFNRMTSKAVLKDVARVLDIPYAESDKMAKMIPVSRGKPTPLK
VMISDETPEPAFKERYDTEPHVRHWLDMAIRIEGTNKTFGVHAAGVVISSQPLDEVVPLQ
KNNDGAVITQYFMEDLESLGLLKMDFLGLRNLTTLKKTADLIKQNQGIDIDLDQLPLDER
KALQIRAKGEHKKLPPDILKTHGLLEEGDLEGIFQLESSGMKQIVKELKPSGIEDISSIL
ALYRPGPLDAGLIPLFIGRKHGREPIRYDHPLLEPILKETYAVLVYQEQIMKMAQDLAGY
SLGEADLLRRAMGKKKASEMQKQREMFIDGAAKNGVEKRIAENLFEQMVNFAEYCLGGET
LILTEEYGLLPIAKIVSEEINCTVYTVDQNGFVYSQPISQWHERGLQEVFEYTLENGQTI
QATKDHKFMTSDGEMLAIDTIFERGLDLKSSDFS
Download sequence
Identical sequences B0JQ14 I4HS17
WP_002797106.1.4043 WP_002797106.1.50331 gi|166366657|ref|YP_001658930.1| 449447.MAE_39160

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]