SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|166366666|ref|YP_001658939.1| from Microcystis aeruginosa NIES-843

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  gi|166366666|ref|YP_001658939.1|
Domain Number - Region: 148-176
Classification Level Classification E-value
Superfamily Zn-binding ribosomal proteins 0.0568
Family Ribosomal protein S27a 0.034
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|166366666|ref|YP_001658939.1|
Sequence length 179
Comment hypothetical protein MAE_39250 [Microcystis aeruginosa NIES-843]
Sequence
MAIYSELPTGQRLYLDNQGPQTIVTLASGAVGQQQQSSSSFATGVWTKEPQIEIIPQGAI
IEIITETGPHRIQIQGSSIGFSSPHTSGVSQSSQSTTATSFSSSPMQPMQPMQPMQPMQP
MKMGNMSMNFAPMEMEMGEMKMSMGDAKTVSKVRFCRQCGAKVAATDRFCSSCGHQLQQ
Download sequence
Identical sequences B0JQ23 I4HS33
gi|166366666|ref|YP_001658939.1| 449447.MAE_39250 WP_002797116.1.4043 WP_002797116.1.50331

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]