SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|166366797|ref|YP_001659070.1| from Microcystis aeruginosa NIES-843

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|166366797|ref|YP_001659070.1|
Domain Number 1 Region: 4-113
Classification Level Classification E-value
Superfamily S-adenosylmethionine decarboxylase 5.49e-35
Family Bacterial S-adenosylmethionine decarboxylase 0.00044
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|166366797|ref|YP_001659070.1|
Sequence length 135
Comment S-adenosylmethionine decarboxylase [Microcystis aeruginosa NIES-843]
Sequence
MTKLGTHLIVDAWQVPADLLNDPERIRRAILDGITAGEATLIDLCVHQFSPHGVTATATL
AESHIAIHTWPEHGYFAADLFFCGAGKPVVAMEILTKSLQAGEIKVRELTRGFPSTAGVY
ESKKEEPLKSSLVMA
Download sequence
Identical sequences A0A0A1VUM3 A0A139GGQ4 B0JR09 I4HIF4
449447.MAE_40560 WP_002795793.1.10452 WP_002795793.1.4043 WP_002795793.1.50331 WP_002795793.1.52201 gi|166366797|ref|YP_001659070.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]