SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|166366824|ref|YP_001659097.1| from Microcystis aeruginosa NIES-843

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|166366824|ref|YP_001659097.1|
Domain Number 1 Region: 28-185
Classification Level Classification E-value
Superfamily SMAD/FHA domain 1.45e-17
Family FHA domain 0.0018
Further Details:      
 
Weak hits

Sequence:  gi|166366824|ref|YP_001659097.1|
Domain Number - Region: 3-26
Classification Level Classification E-value
Superfamily Rubredoxin-like 0.0271
Family Rubredoxin 0.013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|166366824|ref|YP_001659097.1|
Sequence length 187
Comment FHA domain-containing protein [Microcystis aeruginosa NIES-843]
Sequence
MAIVCKVCGYDQNPQGAEYCDACGAELTPSTPPTPPTPVIPDPIPEPTPMPIPQPIAETI
TLTPEPLPQPITPAITTTARLIAKHPNAPVAEFFIDGFTLIGIFDSDTGPVDVDLEKFPD
NETVSRNHAEIYPDGGTWKIKDLGSLNGVFIKPIGQTRFNARITAPTPLSSGDEIAIAKI
RFLFQTP
Download sequence
Identical sequences B0JR36
WP_012266788.1.4043 WP_012266788.1.43975 449447.MAE_40830 gi|166366824|ref|YP_001659097.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]