SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|166366960|ref|YP_001659233.1| from Microcystis aeruginosa NIES-843

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|166366960|ref|YP_001659233.1|
Domain Number 1 Region: 156-242
Classification Level Classification E-value
Superfamily Barwin-like endoglucanases 0.0000000000000192
Family Barwin 0.049
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|166366960|ref|YP_001659233.1|
Sequence length 249
Comment RlpA-like lipoprotein precursor [Microcystis aeruginosa NIES-843]
Sequence
MNKQLINKLQAVTALTVVGTTASIICSQTAGHSNSLTDISLGRQTVIESTSQTILSAFSN
SRTTDSDIKVSRSVQDNANEILKTLESLVDKENTVPASVTPQTQEAIPSTGQPQSQPNQV
KPAPANAPASNPASVTPAEKPKTSPAVKTSSRPRKKGMASWYGPGFHGRRTASGETFNSS
SLTAAHRYLPFGTKVRVTNLRNGRSVVVRINDRGPFSGGRVIDLSRGAAAIIGVFQSGVA
PVVLEVLGR
Download sequence
Identical sequences A0A139GJB0 B0JS83
gi|166366960|ref|YP_001659233.1| 449447.MAE_42190 WP_012266895.1.4043 WP_012266895.1.52201

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]