SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|166367017|ref|YP_001659290.1| from Microcystis aeruginosa NIES-843

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|166367017|ref|YP_001659290.1|
Domain Number 1 Region: 9-236
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 3.13e-61
Family G proteins 0.000000159
Further Details:      
 
Domain Number 2 Region: 308-408
Classification Level Classification E-value
Superfamily EF-Tu/eEF-1alpha/eIF2-gamma C-terminal domain 1.3e-33
Family EF-Tu/eEF-1alpha/eIF2-gamma C-terminal domain 0.00000851
Further Details:      
 
Domain Number 3 Region: 215-311
Classification Level Classification E-value
Superfamily Translation proteins 7.66e-32
Family Elongation factors 0.0000108
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|166367017|ref|YP_001659290.1|
Sequence length 409
Comment elongation factor Tu [Microcystis aeruginosa NIES-843]
Sequence
MARAKFERTKPHVNIGTIGHVDHGKTTLTAAITMTLAALGNAQAKKYDEIDAAPEEKARG
ITINTAHVEYETASRHYAHVDCPGHADYVKNMITGAAQMDGGILVVSAADGPMPQTREHI
LLARQVGVPNLVVFLNKKDMVDDEELLELVELEVRELLTNYDFAGDDIPIIAGSAKEALE
YMTKNPKAQKGDNEWVDAIYELMEAVDSYIPTPERDIDKPFLMAVEDVFSITGRGTVATG
RIERGIVKVGDNVELVGIRETRPTTVTGIEMFKKSLDQGMAGDNAGILLRGIQKTDIERG
MVIAKPGTIKPHTQFEGEVYVLSKEEGGRHTPFFKNYRPQFYVRTTDVTGTIQDYTADDG
STVEMVMPGDRIKMTVELINPIAIEQGMRFAIREGGRTIGSGVISKIIK
Download sequence
Identical sequences B0JSE0 I4I6T8
gi|166367017|ref|YP_001659290.1| WP_004162845.1.4043 WP_004162845.1.50331 449447.MAE_42760

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]