SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|166367026|ref|YP_001659299.1| from Microcystis aeruginosa NIES-843

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|166367026|ref|YP_001659299.1|
Domain Number 1 Region: 7-356
Classification Level Classification E-value
Superfamily Nucleotidylyl transferase 4.35e-108
Family Class I aminoacyl-tRNA synthetases (RS), catalytic domain 0.000000022
Further Details:      
 
Domain Number 2 Region: 358-530
Classification Level Classification E-value
Superfamily Anticodon-binding domain of a subclass of class I aminoacyl-tRNA synthetases 2.43e-36
Family Anticodon-binding domain of a subclass of class I aminoacyl-tRNA synthetases 0.00026
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|166367026|ref|YP_001659299.1|
Sequence length 537
Comment methionyl-tRNA synthetase [Microcystis aeruginosa NIES-843]
Sequence
MNDLNERKTFALTTPLYYVNDIPHIGSAYTTIVADVMARWQRLQGNSVLLITGTDEHGQK
IERTAAAKGLNPQEHCDRIATSFANLWAKLHIQYDRFSRTTAPRHQAIVNEFFERVWEKG
DIYLDRQQGWYCVACEEFKEKRELLDNGCCPIHTNLAAEWRDEENYFFRLSKYQTQLEQF
YQEQPDFIQPESRRNEVLNFVNQGLQDFSISRVNVAWGFPIPHDGQHTIYVWFDALLGYV
TALLDPEDEPTLENALAKWWPIDLHLIGKDILRFHAIYWPAMLMSAGLPLPKRVFGHGFL
TKDGRKMGKSLGNTLDPFDLVDRYGADAVRYYFVKEIELGQDGDFQETRFVNILNADLAN
DLGNLLNRTLGMVKKYCQNIPPQLTGVDIPNDNRLKNMGINLGGIVEQKYDALQFNQACE
EILALIRASNKFIDESAPWSLFKQKQQAAVEQVLYAVLESVRLSAYLLSPIIPTLSSKIY
QQLGFVIDFNTFRSEDGEDPPDGVSFSQHCQWGLPTNPQLGTPEPIFSKLELPLNDS
Download sequence
Identical sequences B0JSE9
gi|166367026|ref|YP_001659299.1| 449447.MAE_42850 WP_012266942.1.4043

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]