SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|166367031|ref|YP_001659304.1| from Microcystis aeruginosa NIES-843

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|166367031|ref|YP_001659304.1|
Domain Number 1 Region: 1-51
Classification Level Classification E-value
Superfamily TTHA1013/TTHA0281-like 1.31e-16
Family TTHA0281-like 0.054
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|166367031|ref|YP_001659304.1|
Sequence length 67
Comment hypothetical protein MAE_42900 [Microcystis aeruginosa NIES-843]
Sequence
MKWRVILEPDPDTNEWAIWCPELPGCTSAGITQEEALNNIREAIELYLQPDAIDLLPGAV
IREVMVG
Download sequence
Identical sequences A0A139GKV9 A0A1V4BQQ0 A0A2H6BNI9 B0JSF4 I4GG23 I4I6Q7 S3JAJ3
449447.MAE_42900 WP_002776494.1.4043 WP_002776494.1.50331 WP_002776494.1.52201 WP_002776494.1.79847 WP_002776494.1.86711 WP_002776494.1.92877 gi|166367031|ref|YP_001659304.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]