SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|166367032|ref|YP_001659305.1| from Microcystis aeruginosa NIES-843

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  gi|166367032|ref|YP_001659305.1|
Domain Number - Region: 193-225
Classification Level Classification E-value
Superfamily Rho N-terminal domain-like 0.000137
Family Rho termination factor, N-terminal domain 0.033
Further Details:      
 
Domain Number - Region: 11-91
Classification Level Classification E-value
Superfamily ParB/Sulfiredoxin 0.00523
Family ParB-like nuclease domain 0.035
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|166367032|ref|YP_001659305.1|
Sequence length 229
Comment hypothetical protein MAE_42910 [Microcystis aeruginosa NIES-843]
Sequence
MEYTDIGTLKYLYLDEIEITNGTDADSFLIEATAKLLQQTGGRNWLPVIVKELSEDRYEV
IGNSFVYAVAERAGLERIWCIIADGTEDARNISRVLAREETPKLNLSTASREEIKSALQF
LIEQPNSPLKTIKLATATARIDEAPRQFWKSLDSIVALKCGITKGKGLDLLKTVFYLTPQ
SQQDAVIEEFSEETLKLKTVSELKTLAKEKGIVGLSKMKKAELVRILAQ
Download sequence
Identical sequences B0JSF5
gi|166367032|ref|YP_001659305.1| 449447.MAE_42910

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]