SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|166367044|ref|YP_001659317.1| from Microcystis aeruginosa NIES-843

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|166367044|ref|YP_001659317.1|
Domain Number 1 Region: 12-248
Classification Level Classification E-value
Superfamily PP2C-like 0.0000000000000562
Family PP2C-like 0.009
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|166367044|ref|YP_001659317.1|
Sequence length 255
Comment hypothetical protein MAE_43030 [Microcystis aeruginosa NIES-843]
Sequence
MWRTLCQSVVGSFHIQAGLPCQDYGAYQVLGQDVLIGAVADGAGSAKHSDLGAKITVKAA
LQFLEENLKKTALAATGTEAELEEIFRRLLAYVQQILQEKAEKEQLYINDLATTLLVVLV
TSKRLAAMQIGDGFIVFKPLGGNYQLLFQPDKGEYINETTFVTSSNALEDMQIKVLTEPV
AFICVATDGVEKVSIDYKNWQPFPPFFQPLEEYLQQTETPLQEDLKEFLMREDLNKLTTD
DKTLLLAFCSETGFV
Download sequence
Identical sequences B0JSG7
gi|166367044|ref|YP_001659317.1| WP_012266955.1.4043 449447.MAE_43030

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]