SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|166367075|ref|YP_001659348.1| from Microcystis aeruginosa NIES-843

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|166367075|ref|YP_001659348.1|
Domain Number 1 Region: 3-114
Classification Level Classification E-value
Superfamily Ribosomal protein L20 1.1e-50
Family Ribosomal protein L20 0.0000182
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|166367075|ref|YP_001659348.1|
Sequence length 115
Comment 50S ribosomal protein L20 [Microcystis aeruginosa NIES-843]
Sequence
MSRVKRGNVARKRRKKVLKLAKGFRGSHSRLFRTANQQVMKALRNAYRDRRKRKRDFRRL
WITRINAAARQQGISYSQLTGQLKKANILLNRKMLAQLAVLDPVAFAKVVETAKG
Download sequence
Identical sequences A0A0K1S0Q5 A0A1E4Q9Q2 A0A1X9L8A2 A0A2H6BN06 A8YE82 B0JSJ8 I4FCF4 I4FU51 I4GGM5 I4GZ47 I4H226 I4I6G4 I4IIR2 I4IPZ4 L7E1E7 L8NRE9 S3J2V1
449447.MAE_43340 WP_002739593.1.15998 WP_002739593.1.20667 WP_002739593.1.23084 WP_002739593.1.24258 WP_002739593.1.4043 WP_002739593.1.42333 WP_002739593.1.43950 WP_002739593.1.43975 WP_002739593.1.50331 WP_002739593.1.5315 WP_002739593.1.62741 WP_002739593.1.77316 WP_002739593.1.7764 WP_002739593.1.86711 WP_002739593.1.88161 WP_002739593.1.92877 gi|166367075|ref|YP_001659348.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]