SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|166367093|ref|YP_001659366.1| from Microcystis aeruginosa NIES-843

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|166367093|ref|YP_001659366.1|
Domain Number 1 Region: 244-755
Classification Level Classification E-value
Superfamily PFL-like glycyl radical enzymes 1.33e-148
Family R1 subunit of ribonucleotide reductase, C-terminal domain 0.00000127
Further Details:      
 
Domain Number 2 Region: 39-241
Classification Level Classification E-value
Superfamily R1 subunit of ribonucleotide reductase, N-terminal domain 1.31e-50
Family R1 subunit of ribonucleotide reductase, N-terminal domain 0.0000557
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|166367093|ref|YP_001659366.1|
Sequence length 770
Comment ribonucleotide reductase subunit alpha [Microcystis aeruginosa NIES-843]
Sequence
MQSKPLTTAVSIHKNNEVIPFRSTPLANMGSHGIRVIRRDGSTTSLNIGKIRDVVEWACE
GKKVNSIALEAGLTTRLRDGITTREIQDNLINCALEMCSPEEPDWRYVAGRLHIWSLWKD
TLVARGYQYGNYEKTVKTQVKKLLYDERILIYSEAELKEAGSWINSDWDIDYDYAGALLI
TSRYLLKNELPQEALLTCSLLLATVEEPANRLPWAKKFYQAIAQRKISLATPILANLRTP
KGSLTSCFILSIDDSLESIFDEITNAARISKNGGGVGVNVSRIRATGSWVMGKANASGGI
IPWIKLLNDTAIAVNQGGRRAGAVTIGVDIWHLDVPEFLEMQTENGDQRRKAYDVFPQLV
ITDEFMRRVINKAEWTLVDPYEVRNKLGIELAELWGEEFEEAYRLVEANLDQEILLYKKI
NARDLFKSIMRSQVETGMPYIAFKDTINRANPNKHDGYIPGVNLCTESFSNVTPDKTAHC
CNLVSLNLANIDREEIESNCQIAVRILDNTIDITNPPFDNAKNHNDKYRTIGVGAMGLAD
WLAKRKLSYNNLSEISNLFEEIGYWCTYSSMELAKERGAYQAFLGSEWSQGKLIGAKPVA
WFLNNAVQPQRWQQLATDIQRFGIRNSHITAIAPNTSSSLVQGCTASVLPVYSRFFYDKW
AKGTVPIAPPFIEEAFWFYSENKNLEQQQVVKAIATMQEWIDTGISMELLFNLNEGVYFP
EEPNRCLTAKDIFDTLVMAWELGCKAIYYIRTVQKDNFRESDDSCSSCAN
Download sequence
Identical sequences B0JSL6 I4I6E4
449447.MAE_43520 WP_004162793.1.4043 WP_004162793.1.50331 gi|166367093|ref|YP_001659366.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]